PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008219992.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 343aa    MW: 38207 Da    PI: 9.1459
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008219992.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-5491361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++
  XP_008219992.1   9 LPPGFRFHPTDEELITFYLINKITDATFTG-RAIADVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNS 102
                     79*************************999.89***************99999****************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++e vg+kktLvfy+grap+gek++Wvmheyr+
  XP_008219992.1 103 vTSEMVGMKKTLVFYRGRAPRGEKSNWVMHEYRI 136
                     89999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-636157IPR003441NAC domain
PROSITE profilePS5100560.1439157IPR003441NAC domain
PfamPF023653.8E-2810136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MTGEQKEELP PGFRFHPTDE ELITFYLINK ITDATFTGRA IADVDLNKCE PWELPAKAKM  60
GEKEWYFFSL RDRKYPTGVR TNRATNTGYW KTTGKDKEIF NSVTSEMVGM KKTLVFYRGR  120
APRGEKSNWV MHEYRIHSKS AFRTSKDEWV VCRVFQKSAG IKKYPTNQSR AAHPYNLEIG  180
PSVVPSPMMQ LGDHQFPYGR NYMTSAELAE ISRVLRTGGS GGGGSSNGTI NVPIQPQFNY  240
PNLGGGGGGG FTISGLNLNL GAPATQPMLR PMPPPQLHHQ GPPAMNHHQQ DVMSNGANNN  300
SLGPDHQAGY GAIDMNNNNA NGNGNRFMNM EHCVDLDTYW PPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54916317171NO APICAL MERISTEM PROTEIN
1ut4_B1e-54916317171NO APICAL MERISTEM PROTEIN
1ut7_A1e-54916317171NO APICAL MERISTEM PROTEIN
1ut7_B1e-54916317171NO APICAL MERISTEM PROTEIN
3swm_A1e-54916320174NAC domain-containing protein 19
3swm_B1e-54916320174NAC domain-containing protein 19
3swm_C1e-54916320174NAC domain-containing protein 19
3swm_D1e-54916320174NAC domain-containing protein 19
3swp_A1e-54916320174NAC domain-containing protein 19
3swp_B1e-54916320174NAC domain-containing protein 19
3swp_C1e-54916320174NAC domain-containing protein 19
3swp_D1e-54916320174NAC domain-containing protein 19
4dul_A1e-54916317171NAC domain-containing protein 19
4dul_B1e-54916317171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008219992.10.0PREDICTED: NAC domain-containing protein 100
TrEMBLM5XQA30.0M5XQA3_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g02710.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50733253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-108NAC domain containing protein 38